alpshiking.swisshikingvacations.comAlpenwild - Alps Hiking
alpshiking.swisshikingvacations.com Profile
Alpshiking.swisshikingvacations.com is a subdomain of Swisshikingvacations.com,
which was created on 2013-12-04,making it 10 years ago.
It has several subdomains, such as switzerlandtravel.swisshikingvacations.com
myswisskitchen.swisshikingvacations.com , among others.
Description：Alps...
Discover alpshiking.swisshikingvacations.com website stats, rating, details and status online.Use our online tools to find owner and admin contact info. Find out where is server located.Read and write reviews or vote to improve it ranking. Check alliedvsaxis duplicates with related css, domain relations, most used words, social networks references. Go to regular site
alpshiking.swisshikingvacations.com Information
| HomePage size: 178.041 KB |
| Page Load Time: 0.1725 Seconds |
| Website IP Address: 162.240.52.86 |
alpshiking.swisshikingvacations.com Similar Website
| Oisans Valley: Outdoor Adventures in the French Alps |
| Bike Oisans | All the info on mountain biking and cycling in Oisans in the French Alps |
| My Swiss Kitchen - Feeding Foodies in the Alps |
| Strava | Running, Cycling & Hiking App - Train, Track & Share |
| Enwild TrailSense – hiking, camping and trail running articles and how-to advice |
| Backpacking and Hiking Forum - Backpackers' Basecamp |
| Fall Hiking Spree | Summit Metro Parks - We're Your Back Yard |
| NJ Hiking: Connect - A Social Network for New Jersey Hiking Enthusiasts |
| Asheville Trails Maps – Asheville hiking trails: Blue Ridge Parkway, Asheville Waterfalls |
| AllTrails: Trail Guides & Maps for Hiking, Camping, and Running | AllTrails |
| The Alps Trail Running Guide |
| The Alpine Property Blog - Selling properties in the Alps since 1999 |
| Alps Tour Golf | |
| Alps |
alpshiking.swisshikingvacations.com PopUrls
| Alps Hiking - Alpenwild https://alpshiking.swisshikingvacations.com/ |
| Newsletter - Alpenwild - Alps Hiking https://alpshiking.swisshikingvacations.com/newsletter/ |
| Woodpeckers, Integral Birds in the Alps - Alpenwild https://alpshiking.swisshikingvacations.com/woodpeckers/ |
| My Europaweg Skywalk Adventure - Alpenwild https://alpshiking.swisshikingvacations.com/skybridge/ |
| Flora in the Alps – The Incredible Houseleek - Alpenwild https://alpshiking.swisshikingvacations.com/houseleek/ |
| Mighty Glaciers and Strong Flowers - Alps Hiking - Alpenwild https://alpshiking.swisshikingvacations.com/saxifrage/ |
| Flora in the Alps – Why are lichen so special? - Alpenwild https://alpshiking.swisshikingvacations.com/lichen/ |
| Mushroom Season - Alps Hiking - Alpenwild https://alpshiking.swisshikingvacations.com/mushrooms/ |
| Wildlife in the Alps coping with winter: Part 2 – Hibernation https://alpshiking.swisshikingvacations.com/hibernation/ |
| August, 2023 - Alpenwild - Alps Hiking https://alpshiking.swisshikingvacations.com/2023/08/ |
alpshiking.swisshikingvacations.com Httpheader
| Date: Mon, 13 May 2024 00:26:17 GMT |
| Server: Apache |
| Link: https://alpshiking.swisshikingvacations.com/wp-json/; rel="https://api.w.org/" |
| Set-Cookie: apbct_timestamp=1715559978; path=/; secure; HttpOnly; SameSite=Lax, apbct_site_landing_ts=1715559978; path=/; secure; HttpOnly; SameSite=Lax, apbct_page_hits=1; path=/; secure; HttpOnly; SameSite=Lax, apbct_cookies_test=%257B%2522cookies_names%2522%253A%255B%2522apbct_timestamp%2522%252C%2522apbct_site_landing_ts%2522%252C%2522apbct_page_hits%2522%255D%252C%2522check_value%2522%253A%2522632357829eb140e6f238c8b35f7717c5%2522%257D; path=/; secure; HttpOnly; SameSite=Lax, apbct_urls=%7B%22alpshiking.swisshikingvacations.com%2F%22%3A%5B1715559978%5D%7D; expires=Thu, 16-May-2024 00:26:18 GMT; Max-Age=259200; path=/; domain=alpshiking.swisshikingvacations.com; secure; HttpOnly; SameSite=Lax, apbct_site_referer=UNKNOWN; expires=Thu, 16-May-2024 00:26:18 GMT; Max-Age=259200; path=/; domain=alpshiking.swisshikingvacations.com; secure; HttpOnly; SameSite=Lax |
| Vary: Accept-Encoding |
| Referrer-Policy: no-referrer-when-downgrade |
| Transfer-Encoding: chunked |
| Content-Type: text/html; charset=UTF-8 |
alpshiking.swisshikingvacations.com Meta Info
| charset="utf-8"/ |
| content="width=device-width, initial-scale=1" name="viewport"/ |
| content="Alps Hiking" name="description" |
| content="max-image-preview:large" name="robots" |
| content="All in One SEO (AIOSEO) 4.6.2" name="generator"/ |
| content="en_US" property="og:locale"/ |
| content="Alpenwild - Alps Hiking" property="og:site_name"/ |
| content="website" property="og:type"/ |
| content="Alpenwild - Alps Hiking" property="og:title"/ |
| content="Alps Hiking" property="og:description"/ |
| content="https://alpshiking.swisshikingvacations.com/" property="og:url"/ |
| content="summary" name="twitter:card"/ |
| content="Alpenwild - Alps Hiking" name="twitter:title"/ |
| content="Alps Hiking" name="twitter:description"/ |
| content="On our Alps Hiking blog, you'll find information about hiking, snowshoeing, wildlife, geology, and more. Our Alpenwild guides and experts update this blog regularly, so it's a living resource for everything you'd like to know. We'll see you on the mountain!" name="description"/ |
| content="index, follow" name="robots"/ |
| content="index, follow, max-snippet:-1, max-image-preview:large, max-video-preview:-1" name="googlebot"/ |
| content="index, follow, max-snippet:-1, max-image-preview:large, max-video-preview:-1" name="bingbot"/ |
| content="Alpenwild | Alps Hiking" property="og:title"/ |
| content="On our Alps Hiking blog, you'll find information about hiking, snowshoeing, wildlife, geology, and more. Our Alpenwild guides and experts update this blog regularly, so it's a living resource for everything you'd like to know. We'll see you on the mountain!" property="og:description"/ |
| content="Alpenwild" property="og:site_name"/ |
| content="summary_large_image" name="twitter:card"/ |
| content="https://i0.wp.com/alpshiking.swisshikingvacations.com/wp-content/uploads/2019/04/cropped-Alpenwild-Logo-New-2019-favicon-photoshop.png?fit=270%2C270&ssl=1" name="msapplication-TileImage"/ |
alpshiking.swisshikingvacations.com Ip Information
| Ip Country: United States |
| City Name: Meridian |
| Latitude: 43.6138 |
| Longitude: -116.3972 |
alpshiking.swisshikingvacations.com Html To Plain Text
Trips Hike Crete Sea to Summit Provence Best of the Swiss Alps Exploring The Jungfrau Italian Dolomites Best of the French Alps St Moritz to Italy Exploring Croatia Italian Lakes Discovery Best of Slovenia and the Julian Alps Trek Tour of the Giants Italian Dolomites Alta Via 1 Chamonix-Zermatt Haute Route Deluxe Haute Route Deluxe Tour du Mont Blanc Via Alpina - Swiss Alpine Route Deluxe Bernese Oberland Traverse Eiger to the Matterhorn England Coast to Coast Rail and Sightseeing Scenic Alps by Rail Cheese, Chocolate, & the Alps Self-Guided - Scenic Alps by Rail Self-Guided- Glacier Express Christmas in Switzerland Scenic Alps by Rail - Christmas Edition Self-Guided Tours Self-Guided Haute Route Self-Guided Tour du Mont Blanc Self-Guided Jungfrau Self-Guided Via Alpina Self-Guided Bernese Oberland Traverse Self-Guided Eiger to the Matterhorn Self-Guided Swiss Alps Self-Guided Austria Zillertal Alps Custom and Guided Tours Private Guided and Custom Trips Tour Add-Ons & Getaways Appenzell -Alpstein Range Zermatt and the Matterhorn Leukerbad -Thermal Hot Springs Principality of Liechtenstein Saas-Fee - Pearl of the Alps Tour Calendar About Our Tours Where We Stay How We Travel FAQ Guided Tours FAQ – Alpenwild Experience FAQ - Tour du Mont Blanc FAQ - Haute Route FAQ - Alps Hiking Tours FAQ- Scenic Alps by Rail Tour FAQ Self-Guided Tours A Self-Guided Tour FAQ Self-Guided FAQ - Haute Route Self-Guided FAQ - Tour du Mont Blanc Self-Guided FAQ - Rail Tours Travel Agents + Alpenwild Why You’ll Love The Alps Plan a Trip Packing Lists Packing List – Alps Trekking Tours Packing List – Alps Hiking Tours Packing List – Alps Walking and Sightseeing Tours Packing List - Winter Tours- Christmas in Switzerland Weather In The Alps Haute Route Essentials Tour du Mont Blanc Essentials Is a Self-Guided Trip for me? Car Travel in Switzerland Maps & Books Book a Trip Book Your Trip Make a PaymentSustainability Commitment Why Choose Alpenwild The Alpenwild Story Guides and Trip Leaders Contact Us 801-226-9026Trip Finder Newsletter Signup Request a Call 801-226-9026 Trips Hike Crete Sea to Summit Provence Best of the Swiss Alps Exploring The Jungfrau Italian Dolomites Best of the French Alps St Moritz to Italy Exploring Croatia Italian Lakes Discovery Best of Slovenia and the Julian Alps Trek Tour of the Giants Italian Dolomites Alta Via 1 Chamonix-Zermatt Haute Route Deluxe Haute Route Deluxe Tour du Mont Blanc Via Alpina - Swiss Alpine Route Deluxe Bernese Oberland Traverse Eiger to the Matterhorn England Coast to Coast Rail and Sightseeing Scenic Alps by Rail Cheese, Chocolate, & the Alps Self-Guided - Scenic Alps by Rail Self-Guided- Glacier Express Christmas in Switzerland Scenic Alps by Rail - Christmas Edition Self-Guided Tours Self-Guided Haute Route Self-Guided Tour du Mont Blanc Self-Guided Jungfrau Self-Guided Via Alpina Self-Guided Bernese Oberland Traverse Self-Guided Eiger to the Matterhorn Self-Guided Swiss Alps Self-Guided Austria Zillertal Alps Custom and Guided Tours Private Guided and Custom Trips Tour Add-Ons & Getaways Appenzell -Alpstein Range Zermatt and the Matterhorn Leukerbad -Thermal Hot Springs Principality of Liechtenstein Saas-Fee - Pearl of the Alps Tour Calendar About Our Tours Where We Stay How We Travel FAQ Guided Tours FAQ – Alpenwild Experience FAQ - Tour du Mont Blanc FAQ - Haute Route FAQ - Alps Hiking Tours FAQ- Scenic Alps by Rail Tour FAQ Self-Guided Tours A Self-Guided Tour FAQ Self-Guided FAQ - Haute Route Self-Guided FAQ - Tour du Mont Blanc Self-Guided FAQ - Rail Tours Travel Agents + Alpenwild Why You’ll Love The Alps Plan a Trip Packing Lists Packing List – Alps Trekking Tours Packing List – Alps Hiking Tours Packing List – Alps Walking and Sightseeing Tours Packing List - Winter Tours- Christmas in Switzerland Weather In The Alps Haute Route Essentials Tour du Mont Blanc Essentials Is a Self-Guided Trip for me? Car Travel in Switzerland Maps & Books Book a Trip Book Your Trip Make a PaymentSustainability Commitment Why Choose Alpenwild The Alpenwild Story Guides and Trip Leaders Contact Us Alps Hiking Enjoy the outdoors when you aren’t out of doors. Hiking above the Aletsch Forest. Photo by Christian Perret, courtesy Switzerland Tourism Travel and Coronavirus: A Message to Our GuestsLoad More Blog Categories Wildlife and Nature Sightseeing and Exploring By Activity Trekking Hiking The Via Alpina Hiking Trail Archives Slovenia Snowshoeing Other Archives October 2023 August 2023 July 2023 June 2023 January 2023 November 2022 March 2022 January 2022 November 2021 October 2021 September 2021 April 2021 March 2021 February 2021 January 2021 December 2020 November 2020 October 2020 September 2020 August 2020 July 2020 June 2020 May 2020 April 2020 March 2020 February 2020 January 2020 December 2019 November 2019 October 2019 September 2019 August 2019 July 2019 June 2019 May 2019 April 2019 March 2019 February 2019 January 2019 December 2018 November 2018 October 2018 September 2018 August 2018 June 2018 May 2018 April 2018 March 2018 February 2018 January 2018 Sign Up for Our Email Newsletter Stay up to date on the latest Alpenwild news. You’re free to opt out at any time. Interests: Hiking and trekking Cultural and gourmet Ski and winter Subscribe Blogs Alps Hiking Blog Switzerland Travel Blog Swiss Food Blog What’s New? Alpenwild in the News Alpenwild Press Room Careers Necessary Info Terms & Conditions Trip insurance Privacy Policy Sitemap Happy Guests Testimonials Returning Guest Perks Alpenwild Recommended Suggested Reading Sustainability Commitment Eco-friendly Travel Videos Copyright © 2005-2024 alpenwild.com. All rights reserved Name * Phone Number * Best time to call (indicate your time zone) * Questions or Comments * Call Me Back Choose Locations * All Locations Austria France Italy Switzerland Slovenia Liechtenstein Ireland Croatia Great Britain Greece Choose Activities * All Activities Culture & History Food & Wine Rail Sightseeing Ski & Winter Trekking/Hiking Walking Spa & Wellness Mountain Scenery Wildlife Choose Date * All Dates January February March April May June July August September October November December Find My Trip First Name * Last Name * Email Address * Interests Hiking and trekking Cultural and gourmet Ski and winter See our Privacy Policy....
alpshiking.swisshikingvacations.com Whois
Domain Name: SWISSHIKINGVACATIONS.COM Registry Domain ID: 1837909687_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.namecheap.com Registrar URL: http://www.namecheap.com Updated Date: 2024-04-29T19:04:04Z Creation Date: 2013-12-04T14:54:23Z Registry Expiry Date: 2024-10-06T11:59:59Z Registrar: NameCheap, Inc. Registrar IANA ID: 1068 Registrar Abuse Contact Email: abuse@namecheap.com Registrar Abuse Contact Phone: +1.6613102107 Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited Name Server: DNS1.REGISTRAR-SERVERS.COM Name Server: DNS2.REGISTRAR-SERVERS.COM DNSSEC: unsigned >>> Last update of whois database: 2024-05-17T15:02:42Z <<<